PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02110.1.g00070.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 148aa    MW: 17156 Da    PI: 10.0053
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02110.1.g00070.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.52e-241056248
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                                  rien   rqvtf+kRr g+lKKA ELS+LCda++ vi+fs++gk+y+
  Zpz_sc02110.1.g00070.1.sm.mk 10 RIENPVHRQVTFCKRRMGLLKKARELSILCDADIGVIVFSPHGKIYD 56
                                  8********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.833161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-27175IPR002100Transcription factor, MADS-box
CDDcd002654.59E-37273No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KARELSILCD ADIGVIVFSP HGKIYDLATN  60
GNMRGLIERY RSTYTKGESS EQDKPQFKMQ IMSRELEMLR NKEGILKAAN DILQQRIIEQ  120
NGILDISGNV MMPQVPYQPA MESNYYFQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9761312e-61EU976131.1 Zea mays clone 645550 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975710.18e-72PREDICTED: MADS-box transcription factor 26-like
SwissprotA2YQK98e-48MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G88e-48MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0E0P9N02e-76A0A0E0P9N0_ORYRU; Uncharacterized protein
STRINGBGIOSGA015021-PA6e-71(Oryza sativa Indica Group)
STRINGSi012632m2e-71(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-40AGAMOUS-like 12